Find Antibodies, Antibody Supplier - GeneTex Inc.
United States
  • Please select
    • All categories
    • Primary antibodies
    • Secondary antibodies
    • Antibody panels
    • Small molecules
    • Proteins
    • Peptides
    • Lysates
    • Slides
    • Sera & plasma
    • Research reagents
    • Research kits
    • Assay kits
    • ELISA kits
    • ELISA pairs
    • Isotype controls
My Account My Cart
Please login Product Support| Company News| Contact Us| SiteMap
  • Primary Antibodies

  • Secondary Antibodies

  • Proteins & Peptides

  • Lysates & Slides

  • Serum & Reagents

  • Research Kits

  • Isotype Controls

  • Home
  • Primary Antibodies
  • Primary antibodies
  • IL21 Receptor antibody

Related products
More Hide
Recently viewed products

1 .GTX13268 IL21 Receptor antibody

GTX101435 beta Catenin antibody [N1N2-2], N-term
Anti-beta Catenin antibody [N1N2-2], N-term used in IHC-P. GTX101435
GTX122148 Histone H3 antibody
Anti-Histone H3 antibody used in IHC-P. GTX122148
GTX128508 mCherry antibody
Anti-mCherry antibody used in IHC-Wm. GTX128508
GTX629448 5-Methylcytosine / 5-mC antibody [GT4111]
Anti-5-Methylcytosine / 5-mC antibody [GT4111] used in Dot. GTX629448
GTX629765 5-Hydroxymethylcytosine / 5-hmC antibody [GT13612]
Anti-5-Hydroxymethylcytosine / 5-hmC antibody [GT13612] used in MeDIP. GTX629765
GTX629890 SQSTM1 / P62 antibody [GT1478]
Anti-SQSTM1 / P62 antibody [GT1478] used in WB. GTX629890
ECL kit RIPA Extraction Kit Protein Ladder

IL21 Receptor antibody


  • Host / ClonalityRabbit Polyclonal
  • ApplicationsELISA, FACS, IHC
  • Species reactivityMouse
Cat No: GTX13268
Package Price Qty
50 μgUSD 319.00
Add to cart
 
  • Anti-IL21 Receptor antibody used in Immunohistochemistry (IHC). GTX13268
LinkButton
  • Datasheet
  • Application Information: IL21 Receptor antibody

Catalog Number GTX13268
☆☆☆☆☆
( 0 )
Publication ( 0 )
Product Name IL21 Receptor antibody
See all IL21 Receptor products
ApplicationsELISA, FACS, IHC
Application NoteFor ELISA (peptide): Use at a dilution of 1:100,000. For FACS: Use at a dilution of 1:20. For IHC: Use at a dilution of 1:300. Optimal dilutions/concentrations should be determined by the researcher.
Positive ControlsMouse thymus/spleen
Form SuppliedLiquid
Concentration1 mg/ml (Please refer to the vial label for the specific concentration)
PurificationImmunogen affinity purified

  • Specifications: IL21 Receptor antibody

Full Nameinterleukin 21 receptor
BackgroundThe protein encoded by this gene is a cytokine receptor for interleukin 21 (IL21). It belongs to the type I cytokine receptors, and has been shown to form a heterodimeric receptor complex with the common gamma-chain, a receptor subunit also shared by the receptors for interleukin 2 (IL2) and interleukin 5 (IL5). This receptor transduces the growth promoting signal of IL21, and is important for the proliferation and differentiation of T cells, B cells, and natural killer (NK) cells. The ligand binding of this receptor leads to the activation of multiple downstream signaling molecules, including JAK1, JAK3, STAT1, and STAT3. Knockout studies of a similar gene in mouse suggest a role for this gene in regulating immunoglobulin production. Three alternatively spliced transcript variants encoding the same protein have been described.
SynonymsIL21 R, IL21R, NILR
HostRabbit
ClonalityPolyclonal
IsotypeIgG
ImmunogenSynthetic peptide: CVLETRSPNPSILSLTWQDEYEELQDQETF, corresponding to N-term amino acids 35-65 of Mouse IL21 Receptor.
Antigen SpeciesMouse
Species ReactivityMouse
ConjugationUnconjugated

  • Storage Conditions: IL21 Receptor antibody

Storage Buffer10 mM KHPO4, 140 mM NaCl containing 0.1 % sodium azide
Storage InstructionKeep as concentrated solution. Store at 4ºC short term. For extended storage aliquot and store at -20ºC or below. Avoid freeze-thaw cycles.
NotesFor In vitro laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.
ResearchArea
  • Disease Related > Diabetes
More Hide
IL21 Receptor antibody validated data
  • Anti-IL21 Receptor antibody used in Immunohistochemistry (IHC). GTX13268
    • GTX13268 IHC Image
      Mouse thymus IL21R N term
      Top
  • Anti-IL21 Receptor antibody used in Immunohistochemistry (IHC). GTX13268
    • GTX13268 IHC Image
      Mouse thymus IL21R N term
      Top
Back to Top
  • Product types

    Primary Antibodies Secondary Antibodies Proteins & Peptides Lysates & Slides Serum & Reagents Research Kits Isotype Controls

    Resources

    Literature Newsletters Protocols Pathways

  • Research Areas

    Cancer Cell Biology Neuroscience Metabolism Epigenetics Immunology Signal Transduction Infectious Disease Disease Related Stem Cell Development Zebrafish Epitope Tags

  • Company

    About Us News Rewards Program Recent Publications Contact Us Policy Guarantee Careers Sitemap

    Support

    Protocols Technical Tips FAQ

  • Distributors

    Custom Antibodies

    Member Account

    • Youtube Youtube
    • Facebook Facebook
    • Twitter Twitter
    • LinkedIn LinkedIn
    • Weibo Weibo
© 2013 GeneTex Inc. All rights reserved.
All products are for research use only—Not for use in diagnostic procedures.