GeneTex
  • Country / Location Selection

United States (US)

AHR antibody

Anti-AHR antibody used in IHC (Paraffin sections) (IHC-P). GTX03719
Anti-AHR antibody used in IHC (Paraffin sections) (IHC-P). GTX03719
Anti-AHR antibody used in IHC (Paraffin sections) (IHC-P). GTX03719
Anti-AHR antibody used in IHC (Paraffin sections) (IHC-P). GTX03719
Anti-AHR antibody used in Flow cytometry (FACS). GTX03719
Anti-AHR antibody used in IHC (Paraffin sections) (IHC-P). GTX03719
Anti-AHR antibody used in IHC (Paraffin sections) (IHC-P). GTX03719
Anti-AHR antibody used in Western Blot (WB). GTX03719
Anti-AHR antibody used in Flow cytometry (FACS). GTX03719
Anti-AHR antibody used in IHC (Paraffin sections) (IHC-P). GTX03719

Cat. No. GTX03719

Host

Rabbit

Clonality

Polyclonal

Isotype

IgG

Application

WB, ICC/IF, IHC-P, FACS

Reactivity

Human, Mouse, Rat
Package
100 μg ($449)

APPLICATION

Application Note

*Optimal dilutions/concentrations should be determined by the researcher.
Application Recommended Dilution
WB 0.1-0.5μg/ml
ICC/IF 0.5-1μg/ml
IHC-P 0.5-1μg/ml
FACS 1-3μg/1x106 cells
Not tested in other applications.

Calculated MW

96 kDa. ( Note )

PROPERTIES

Form

Liquid

Buffer

4mg Trehalose, 0.9mg NaCl, 0.2mg Na₂HPO₄

Preservative

0.05mg sodium azide

Storage

Store as concentrated solution. Centrifuge briefly prior to opening vial. For short-term storage (1-2 weeks), store at 4ºC. For long-term storage, aliquot and store at -20ºC or below. Avoid multiple freeze-thaw cycles.

Concentration

0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Antigen Species

Human

Immunogen

A synthetic peptide corresponding to a sequence of human AHR (AFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHH).

Purification

Purified by antigen-affinity chromatography

Conjugation

Unconjugated

Note

For laboratory research use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

Purchasers shall not, and agree not to enable third parties to, analyze, copy, reverse engineer or otherwise attempt to determine the structure or sequence of the product.

TARGET

Synonyms

aryl hydrocarbon receptor , bHLHe76

Cellular Localization

Cytoplasm , Nucleus

Background

The protein encoded by this gene is a ligand-activated helix-loop-helix transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. This receptor has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. Before ligand binding, the encoded protein is sequestered in the cytoplasm; upon ligand binding, this protein moves to the nucleus and stimulates transcription of target genes. [provided by RefSeq, Sep 2015]

Database

Research Area

DATA IMAGES

Anti-AHR antibody used in IHC (Paraffin sections) (IHC-P). GTX03719

GTX03719 IHC-P Image

IHC-P analysis of human tonsil tissue using GTX03719 AHR antibody.
Antigen retrieval : Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins
Dilution : 2μg/ml

Anti-AHR antibody used in IHC (Paraffin sections) (IHC-P). GTX03719

GTX03719 IHC-P Image

IHC-P analysis of mouse liver tissue using GTX03719 AHR antibody.
Antigen retrieval : Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins
Dilution : 2μg/ml

Anti-AHR antibody used in IHC (Paraffin sections) (IHC-P). GTX03719

GTX03719 IHC-P Image

IHC-P analysis of human cholangiocarcinoma tissue using GTX03719 AHR antibody.
Antigen retrieval : Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins
Dilution : 2μg/ml

Anti-AHR antibody used in IHC (Paraffin sections) (IHC-P). GTX03719

GTX03719 IHC-P Image

IHC-P analysis of rat small intestine tissue using GTX03719 AHR antibody.
Antigen retrieval : Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins
Dilution : 2μg/ml

Anti-AHR antibody used in Flow cytometry (FACS). GTX03719

GTX03719 FACS Image

FACS analysis of U937 cells using GTX03719 AHR antibody.
Blue : Primary antibody
Green : Isotype control
Red : Unlabelled sample
Antibody amount : 1μg/1x10⁶ cells

Anti-AHR antibody used in IHC (Paraffin sections) (IHC-P). GTX03719

GTX03719 IHC-P Image

IHC-P analysis of rat spleen tissue using GTX03719 AHR antibody.
Antigen retrieval : Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins
Dilution : 2μg/ml

Anti-AHR antibody used in IHC (Paraffin sections) (IHC-P). GTX03719

GTX03719 IHC-P Image

IHC-P analysis of human oesophagus tissue using GTX03719 AHR antibody.
Antigen retrieval : Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins
Dilution : 2μg/ml

Anti-AHR antibody used in Western Blot (WB). GTX03719

GTX03719 WB Image

WB analysis of recombinant human AHR protein using GTX03719 AHR antibody.
Dilution : 0.5 μg/mL
Loading : 1 ng

Anti-AHR antibody used in Flow cytometry (FACS). GTX03719

GTX03719 FACS Image

FACS analysis of U87 cells using GTX03719 AHR antibody.
Blue : Primary antibody
Green : Isotype control
Red : Unlabelled sample
Antibody amount : 1μg/1x10⁶ cells

Anti-AHR antibody used in IHC (Paraffin sections) (IHC-P). GTX03719

GTX03719 IHC-P Image

IHC-P analysis of human placenta tissue using GTX03719 AHR antibody.
Antigen retrieval : Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins
Dilution : 2μg/ml

REFERENCE

There are currently no references for AHR antibody (GTX03719). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for AHR antibody (GTX03719). Be the first to share your experience with this product.
Package List Price ($)
$ 449