GeneTex
  • Country / Location Selection

United States (US)

AMH antibody [5/6]

Anti-AMH antibody [5/6] used in IHC (Paraffin sections) (IHC-P). GTX42793

Cat No. GTX42793

Host

Mouse

Clonality

Monoclonal

Clone Name

5/6

Isotype

IgG1

Application

WB, IHC-P

Reactivity

Human, Mouse, Sheep, Baboon, Squirrel monkey
Package
100 μl ($339)

APPLICATION

Application Note

*Optimal dilutions/concentrations should be determined by the researcher.
Application Dilution
WB Assay dependent
IHC-P 1/20-1/40

Note :

IHC-P
This product requires antigen retrieval using heat treatment prior to staining of paraffin sections. Sodium citrate buffer pH 6.0 is recommended for this purpose.

Not tested in other applications.

Calculated MW

59 kDa. ( Note )

PROPERTIES

Form

Liquid

Buffer

Tissue Culture Supernatant with 0.1% Sodium Azide

Storage

Store as concentrated solution. Centrifuge briefly prior to opening vial. For short-term storage (1-2 weeks), store at 4ºC. For long-term storage, aliquot and store at -20ºC or below. Avoid multiple freeze-thaw cycles.

Antigen Species

Human

Immunogen

Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC)

Purification

Tissue Culture Supernatant

Conjugation

Unconjugated

Note

For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

anti-Mullerian hormone , MIF , MIS

Cellular Localization

Secreted

Background

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate N- and C-terminal cleavage products that homodimerize and associate to form a biologically active noncovalent complex. This complex binds to the anti-Mullerian hormone receptor type 2 and causes the regression of Mullerian ducts in the male embryo that would otherwise differentiate into the uterus and fallopian tubes. This protein also plays a role in Leydig cell differentiation and function and follicular development in adult females. Mutations in this gene result in persistent Mullerian duct syndrome. [provided by RefSeq, Jul 2016]

Database

Research Area

DATA IMAGES

Anti-AMH antibody [5/6] used in IHC (Paraffin sections) (IHC-P). GTX42793

GTX42793 IHC-P Image

IHC-P analysis of ovarian tissue section from a 25 day old mouse using GTX42793 AMH antibody [5/6].

REFERENCE

There are currently no references for AMH antibody [5/6] (GTX42793). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for AMH antibody [5/6] (GTX42793). Be the first to share your experience with this product.
SDS
Sodium Azide.pdf