GeneTex
  • Country / Location Selection

United States (US)

Heme Oxygenase 1 antibody [HO-1-1]

Anti-Heme Oxygenase 1 antibody [HO-1-1] used in IHC (Paraffin sections) (IHC-P). GTX13248
Anti-Heme Oxygenase 1 antibody [HO-1-1] used in Western Blot (WB). GTX13248

Cat No. GTX13248

Host

Mouse

Clonality

Monoclonal

Clone Name

HO-1-1

Isotype

IgG1

Application

WB, ICC/IF, IHC-P, FACS

Reactivity

Human, Mouse, Rat, Bovine, Dog
Package
50 μg ($379)

APPLICATION

Application Note

For FACS: Use at a concentration of 10 μg/ml. Foe WB: Use at a concentration of 4 μg/ml. Detects a band of approximately 32 kDa. Optimal dilutions/concentrations should be determined by the end user.

Calculated MW

33 kDa. ( Note )

Positive Control

Recombinant Human or Rat HO-1 (Hsp32) Protein

PROPERTIES

Form

Liquid

Buffer

PBS, 50% Glycerol

Preservative

0.09% Sodium azide

Storage

Store as concentrated solution. Centrifuge briefly prior to opening vial. For short-term storage (1-2 weeks), store at 4ºC. For long-term storage, aliquot and store at -20ºC or below. Avoid multiple freeze-thaw cycles.

Concentration

1 mg/ml (Please refer to the vial label for the specific concentration.)

Antigen Species

Human

Immunogen

Synthetic peptide: MERPQPDSMPQDLSEALKEATKEVHTQAEN, corresponding to amino acids 1-30 of Human Heme Oxygenase 1.

Purification

Protein G purified

Conjugation

Unconjugated

Note

For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

heme oxygenase 1 , HMOX1D , HO-1 , HSP32 , bK286B10

Cellular Localization

Microsome , Endoplasmic reticulum membrane

Background

Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. [provided by RefSeq, Jul 2008]

Database

Research Area

DATA IMAGES

Anti-Heme Oxygenase 1 antibody [HO-1-1] used in IHC (Paraffin sections) (IHC-P). GTX13248

GTX13248 IHC-P Image

Immunohistochemistry analysis of human spleen tissue stained with HO-1, mAb (HO-1-1) at 10μg/ml.

Anti-Heme Oxygenase 1 antibody [HO-1-1] used in Western Blot (WB). GTX13248

GTX13248 WB Image

Western blot analysis of HO-1 (Hsp32), mAb (HO-1-1)
Lane 1: MW marker
Lane 2: HO-1 (rat), (recombinant)
Lane 3: HO-1 (human), (recombinant)
Lane 4: HO-2 (human), (recombinant)
Lane 5: MDBK cell lysate
Lane 6: Dog liver microsome
Lane 7: Mouse liver microsome.

REFERENCE

There are currently no references for Heme Oxygenase 1 antibody [HO-1-1] (GTX13248). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for Heme Oxygenase 1 antibody [HO-1-1] (GTX13248). Be the first to share your experience with this product.
SDS
Glycerol.pdf
Sodium Azide.pdf
Package List Price ($)
$ 379