GeneTex
  • Country / Location Selection

United States (US)

Heme Oxygenase 1 antibody [HO-1-1]

Anti-Heme Oxygenase 1 antibody [HO-1-1] used in IHC (Paraffin sections) (IHC-P). GTX13248
Anti-Heme Oxygenase 1 antibody [HO-1-1] used in Western Blot (WB). GTX13248

Cat No. GTX13248

Host

Mouse

Clonality

Monoclonal

Clone Name

HO-1-1

Isotype

IgG1

Application

WB, ICC/IF, IHC-P, FACS

Reactivity

Human, Mouse, Rat, Bovine, Dog
Package
50 μg ($319)

APPLICATION

Application Note

For FACS: Use at a concentration of 10 μg/ml. Foe WB: Use at a concentration of 4 μg/ml. Detects a band of approximately 32 kDa. Optimal dilutions/concentrations should be determined by the end user.

Calculated MW

33 kDa. ( Note )

Positive Control

Recombinant Human or Rat HO-1 (Hsp32) Protein

PROPERTIES

Form

Liquid

Buffer

Phosphate-buffered saline containing 0.09% sodium azide and 50% glycerol

Storage

Store as concentrated solution. Centrifuge briefly prior to opening vial. For short-term storage (1-2 weeks), store at 4ºC. For long-term storage, aliquot and store at -20ºC or below. Avoid multiple freeze-thaw cycles.

Concentration

1 mg/ml (Please refer to the vial label for the specific concentration.)

Antigen Species

Human

Immunogen

Synthetic peptide: MERPQPDSMPQDLSEALKEATKEVHTQAEN, corresponding to amino acids 1-30 of Human Heme Oxygenase 1.

Purification

Protein G purified

Conjugation

Unconjugated

Note

For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

Heme Oxygenase 1 , Hmox1D , Ho-1 , Hsp32 , Bk286B10 , Hmox1

Background

Heme oxygenase (HO) is a microsomal enzyme that catalyzes the oxidation of heme to the antioxidant molecules, biliverdin and carbon monoxide. HO consists of two homologous isozymes, an inducible HO1 and a constitutively expressed HO2. HO1 is induced by a wide variety of stimuli including conditions of oxidative stress, inflammatory agents, transforming growth factor beta and heat shock. The increase in expression of HO1 is thought to be a cellular defense mechanism against oxidative stress since elevated HO could eventually generate more bilirubin, an anti-oxidant.

Database

Research Area

DATA IMAGES

Anti-Heme Oxygenase 1 antibody [HO-1-1] used in IHC (Paraffin sections) (IHC-P). GTX13248

GTX13248 IHC-P Image

Immunohistochemistry analysis of human spleen tissue stained with HO-1, mAb (HO-1-1) at 10μg/ml.

Anti-Heme Oxygenase 1 antibody [HO-1-1] used in Western Blot (WB). GTX13248

GTX13248 WB Image

Western blot analysis of HO-1 (Hsp32), mAb (HO-1-1)
Lane 1: MW marker
Lane 2: HO-1 (rat), (recombinant)
Lane 3: HO-1 (human), (recombinant)
Lane 4: HO-2 (human), (recombinant)
Lane 5: MDBK cell lysate
Lane 6: Dog liver microsome
Lane 7: Mouse liver microsome.

REFERENCE

There are currently no references for Heme Oxygenase 1 antibody [HO-1-1] (GTX13248). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for Heme Oxygenase 1 antibody [HO-1-1] (GTX13248). Be the first to share your experience with this product.
Package List Price ($)
$ 319