GeneTex
  • Country / Location Selection

United States (US)

Heme Oxygenase 1 antibody [HO-1-1]

Anti-Heme Oxygenase 1 antibody [HO-1-1] used in IHC (Paraffin sections) (IHC-P). GTX13248
Anti-Heme Oxygenase 1 antibody [HO-1-1] used in Western Blot (WB). GTX13248

Cat No. GTX13248

Host Mouse
Clonality Monoclonal
Clone Name HO-1-1
Isotype IgG1
Application WB, ICC/IF, IHC-P, FACS
Reactivity Human, Mouse, Rat, Bovine, Dog
Package
50 μg ($319)
APPLICATION

Application Note

For FACS: Use at a concentration of 10 μg/ml. Foe WB: Use at a concentration of 4 μg/ml. Detects a band of approximately 32 kDa. Optimal dilutions/concentrations should be determined by the end user.

Calculated MW

33 kDa. ( Note )

Positive Control

Recombinant Human or Rat HO-1 (Hsp32) Protein
PROPERTIES

Form

Liquid

Buffer

Phosphate-buffered saline containing 0.09% sodium azide and 50% glycerol

Storage

Store as concentrated solution. Centrifuge briefly prior to opening vial. For short-term storage (1-2 weeks), store at 4ºC. For long-term storage, aliquot and store at -20ºC or below. Avoid multiple freeze-thaw cycles.

Concentration

1 mg/ml (Please refer to the vial label for the specific concentration.)

Antigen Species

Human

Immunogen

Synthetic peptide: MERPQPDSMPQDLSEALKEATKEVHTQAEN, corresponding to amino acids 1-30 of Human Heme Oxygenase 1.

Purification

Protein G purified

Conjugation

Unconjugated

Note

For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.
TARGET

Synonyms

Heme Oxygenase 1,Hmox1D,Ho-1,Hsp32,Bk286B10,Hmox1

Background

Heme oxygenase (HO) is a microsomal enzyme that catalyzes the oxidation of heme to the antioxidant molecules, biliverdin and carbon monoxide. HO consists of two homologous isozymes, an inducible HO1 and a constitutively expressed HO2. HO1 is induced by a wide variety of stimuli including conditions of oxidative stress, inflammatory agents, transforming growth factor beta and heat shock. The increase in expression of HO1 is thought to be a cellular defense mechanism against oxidative stress since elevated HO could eventually generate more bilirubin, an anti-oxidant.

Database

Research Area

DATA IMAGES
Anti-Heme Oxygenase 1 antibody [HO-1-1] used in IHC (Paraffin sections) (IHC-P). GTX13248

GTX13248 IHC-P Image

Immunohistochemistry analysis of human spleen tissue stained with HO-1, mAb (HO-1-1) at 10µg/ml.

Anti-Heme Oxygenase 1 antibody [HO-1-1] used in Western Blot (WB). GTX13248

GTX13248 WB Image

Western blot analysis of HO-1 (Hsp32), mAb (HO-1-1)
Lane 1: MW marker
Lane 2: HO-1 (rat), (recombinant)
Lane 3: HO-1 (human), (recombinant)
Lane 4: HO-2 (human), (recombinant)
Lane 5: MDBK cell lysate
Lane 6: Dog liver microsome
Lane 7: Mouse liver microsome.

REFERENCE
There are currently no references for Heme Oxygenase 1 antibody [HO-1-1] (GTX13248). Be the first to share your publications with this product.
REVIEW
There are currently no reviews for Heme Oxygenase 1 antibody [HO-1-1] (GTX13248). Be the first to share your experience with this product.
Package List Price ($)
$ 319