GeneTex
  • Country / Location Selection

United States (US)

HtrA1 antibody

Anti-HtrA1 antibody used in Western Blot (WB). GTX00643
Anti-HtrA1 antibody used in IHC (Paraffin sections) (IHC-P). GTX00643

Cat No. GTX00643

Host

Rabbit

Clonality

Polyclonal

Isotype

IgG

Application

WB, IHC-P

Reactivity

Human, Mouse, Rat
Package
100 μg ($329)

APPLICATION

Application Note

*Optimal dilutions/concentrations should be determined by the researcher.
Application Dilution
WB 0.1-0.5μg/ml
IHC-P 0.5-1μg/ml
Not tested in other applications.

Calculated MW

51 kDa. ( Note )

PROPERTIES

Form

Liquid

Buffer

4mg Trehalose, 0.9mg NaCl, 0.2mg Na₂HPO₄, 0.05mg sodium azide

Storage

Store as concentrated solution. Centrifuge briefly prior to opening vial. For short-term storage (1-2 weeks), store at 4ºC. For long-term storage, aliquot and store at -20ºC or below. Avoid multiple freeze-thaw cycles.

Concentration

0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Antigen Species

Human

Immunogen

A synthetic peptide corresponding to a sequence of human HTRA1 (QLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIAD).

Purification

Purified by antigen-affinity chromatography

Conjugation

Unconjugated

Note

For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

ARMD7 , CADASIL2 , CARASIL , HTRA1 , HtrA , HtrA serine peptidase 1 , L56 , ORF480 , PRSS11 , HtrA1

Cellular Localization

Secreted,Cytoplasm,Cytosol

Background

This gene encodes a member of the trypsin family of serine proteases. This protein is a secreted enzyme that is proposed to regulate the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins. It has also been suggested to be a regulator of cell growth. Variations in the promoter region of this gene are the cause of susceptibility to age-related macular degeneration type 7. [provided by RefSeq, Jul 2008]

Database

Research Area

DATA IMAGES

Anti-HtrA1 antibody used in Western Blot (WB). GTX00643

GTX00643 WB Image

WB analysis of various samples using GTX00643 HtrA1 antibody.
Lane 1 : MCF-7 whole cell lysates
Lane 2 : rat heart tissue lysates
Lane 3 : mouse heart tissue lysates
Dilution : 0.5μg/ml
Loading : 50μg per lane

Anti-HtrA1 antibody used in IHC (Paraffin sections) (IHC-P). GTX00643

GTX00643 IHC-P Image

IHC-P analysis of human rectal cancer tissue using GTX00643 HtrA1 antibody.
Antigen retrieval : Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins
Dilution : 1 μg/ml

REFERENCE

There are currently no references for HtrA1 antibody (GTX00643). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for HtrA1 antibody (GTX00643). Be the first to share your experience with this product.
SDS
Sodium Azide.pdf
Package List Price ($)
$ 329