GeneTex
  • Country / Location Selection

United States (US)

Human BCA1 protein (active)

Cat No. GTX48076-pro

Application

Functional Assay

Species

Human
Package
20 μg ($369)
PRODUCT

Summary

Recombinant Human BCA-1 is a 10.3 kDa protein containing 87 amino acid residues including the four highly conserved cysteine residues present in CXC chemokines.

APPLICATION

Application Note

Determined by its ability to chemoattract human B cells using a concentration range of 1.0-10.0 ng/ml.

PROPERTIES

Form

Lyophilized powder

Buffer

Batch dependent (please contact us for details)

Storage

Store at -20ºC or below. After reconstitution, keep as concentrated solution. Avoid freeze-thaw cycles.

Region/Sequence

VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP

Expression System

E. Coli

Purity

> 98%

Endotoxin

< 1 EU/μg

Conjugation

Unconjugated

Note

For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

C-X-C motif chemokine ligand 13 , ANGIE , ANGIE2 , BCA-1 , BCA1 , BLC , BLR1L , SCYB13

Background

B lymphocyte chemoattractant, independently cloned and named Angie, is an antimicrobial peptide and CXC chemokine strongly expressed in the follicles of the spleen, lymph nodes, and Peyer's patches. It preferentially promotes the migration of B lymphocytes (compared to T cells and macrophages), apparently by stimulating calcium influx into, and chemotaxis of, cells expressing Burkitt's lymphoma receptor 1 (BLR-1). It may therefore function in the homing of B lymphocytes to follicles. [provided by RefSeq, Oct 2014]

Database

Research Area

REFERENCE

There are currently no references for Human BCA1 protein (active) (GTX48076-pro). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for Human BCA1 protein (active) (GTX48076-pro). Be the first to share your experience with this product.
Package List Price ($)
$ 369