GeneTex
  • Country / Location Selection

United States (US)

Human BMP6 protein (active)

Cat No. GTX48467-pro

Application

Functional Assay

Species

Human
Package
10 μg ($369)
PRODUCT

Summary

Recombinant human BMP-6 is a 26.2 kDa homodimeric glycoprotein consisting of two 117 amino acid subunits, which correspond to amino acid residues 397 to 513 of the full-length BMP-6 precursor.

APPLICATION

Application Note

Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells. The expected ED₅₀ this effect is 0.03-0.06 μg/ml.

PROPERTIES

Form

Lyophilized powder

Buffer

Batch dependent (please contact us for details)

Storage

Store at -20ºC or below. After reconstitution, keep as concentrated solution. Avoid freeze-thaw cycles.

Region/Sequence

VSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH

Expression System

HEK293 cells

Purity

> 95%

Endotoxin

< 1 EU/μg

Conjugation

Unconjugated

Note

For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

bone morphogenetic protein 6 , VGR , VGR1

Background

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates a wide range of biological processes including iron homeostasis, fat and bone development, and ovulation. Differential expression of this gene may be associated with progression of breast and prostate cancer. Mutations in this gene may be associated with iron overload in human patients. [provided by RefSeq, Jul 2016]

Database

  • Gene ID: 654 BMP6

Research Area

REFERENCE

There are currently no references for Human BMP6 protein (active) (GTX48467-pro). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for Human BMP6 protein (active) (GTX48467-pro). Be the first to share your experience with this product.