GeneTex
  • Country / Location Selection

United States (US)

Human Betacellulin protein (active)

Cat No. GTX48223-pro

Application

Functional Assay

Species

Human
Package
20 μg ($369)
PRODUCT

Summary

Recombinant human Betacellulin is a 9.0 kDa monomeric protein, containing 80 amino residues, which comprises the mature EGF homologous portion of the Betacellulin protein.

APPLICATION

Application Note

The ED₅₀ was determined by the dose-dependent stimulation of the proliferation of murine Balb/3T3 cells is < 0.05 ng/ml.

PROPERTIES

Form

Lyophilized powder

Buffer

Batch dependent (please contact us for details)

Storage

Store at -20ºC or below. After reconstitution, keep as concentrated solution. Avoid freeze-thaw cycles.

Region/Sequence

DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY

Expression System

E. Coli

Purity

> 98%

Endotoxin

< 1 EU/μg

Conjugation

Unconjugated

Note

For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

betacellulin

Background

This gene encodes a member of the epidermal growth factor (EGF) family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the secreted growth factor. A secreted form and a membrane-anchored form of this protein bind to multiple different EGF receptors. This protein promotes pancreatic cell proliferation and insulin secretion, as well as retinal vascular permeability. Mutations in this gene may be associated with type 2 diabetes in human patients. [provided by RefSeq, Nov 2015]

Database

  • Gene ID: 685 BTC

REFERENCE

There are currently no references for Human Betacellulin protein (active) (GTX48223-pro). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for Human Betacellulin protein (active) (GTX48223-pro). Be the first to share your experience with this product.
Package List Price ($)
$ 369