GeneTex
  • Country / Location Selection

United States (US)

Human CCL14 protein

Cat No. GTX29846-pro

Species

Human
Package
10 μg ($299)
PRODUCT

Summary

HCC-1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 72 amino acids and having a molecular mass of 8.411 kDa.

PROPERTIES

Form

Lyophilized powder

Buffer

Lyophilized from 20 mM PBS (pH 7.4), 150 mM NaCl. Reconstitute with ddH₂O but not less than 100 μg/ml.

Storage

Store at -20ºC or below. After reconstitution, keep as concentrated solution. Aliquot and avoid freeze-thaw cycles.

Region/Sequence

TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN.

Expression System

E. coli

Purity

> 98% by SDS-PAGE and HPLC.

Endotoxin

< 1 EU/μg

Conjugation

Unconjugated

Note

For In vitro laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

C-C motif chemokine ligand 14 , CC-1 , CC-3 , CKB1 , HCC-1 , HCC-1(1-74) , HCC-1/HCC-3 , HCC-3 , MCIF , NCC-2 , NCC2 , SCYA14 , SCYL2 , SY14

Database

  • Gene ID: 6358 CCL14

Research Area

REFERENCE

There are currently no references for Human CCL14 protein (GTX29846-pro). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for Human CCL14 protein (GTX29846-pro). Be the first to share your experience with this product.
SDS
PBS.pdf
Package List Price ($)
$ 299