GeneTex
  • Country / Location Selection

United States (US)

Human CDKN2A / p16INK4a protein

Cat No. GTX53844-pro

Species

Human
Package
20 μg ($199)
PRODUCT

Summary

Recombinant p16-INK4a is a 16.5 kDa protein containing 156 amino acid residues. Verified by N-terminal and Mass Spectrometry analyses (when applicable).

PROPERTIES

Form

Lyophilized powder

Buffer

Batch dependent (please contact us for details)

Storage

Store at -20ºC or below. After reconstitution, keep as concentrated solution. For long-term storage, we recommend adding a carrier protein (0.1% HAS or BSA), then aliquot and store at -20ºC or below. Avoid multiple freeze-thaw cycles.

Region/Sequence

MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQ VMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHR AGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDA AEGPSDIPD

Expression System

E. coli

Purity

≥ 95% by SDS-PAGE and HPLC.

Endotoxin

< 1 EU/μg

Conjugation

Unconjugated

Note

For In vitro laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

cyclin dependent kinase inhibitor 2A , ARF , CDK4I , CDKN2 , CMM2 , INK4 , INK4A , MLM , MTS-1 , MTS1 , P14 , P14ARF , P16 , P16-INK4A , P16INK4 , P16INK4A , P19 , P19ARF , TP16

Database

Research Area

REFERENCE

There are currently no references for Human CDKN2A / p16INK4a protein (GTX53844-pro). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for Human CDKN2A / p16INK4a protein (GTX53844-pro). Be the first to share your experience with this product.