GeneTex
United States (US)

Human CXCL10 / IP10 protein

Cat No. GTX29810-pro

Species Human
PRODUCT

Product Description

IP-10 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 77 amino acids and having a molecular mass of 8.6 kDa.
APPLICATION

Calculated MW

10.88 kDa. ( Note )
PROPERTIES

Form

Lyophilized powder

Buffer

Reconstitute with ddH₂O to 0.1-1.0 mg/ml.

Storage

Store at -20ºC or below. After reconstitution, keep as concentrated solution. Aliquot and avoid freeze-thaw cycles.

Region/Sequence

VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKA IKNLLKAVSKEMSKRSP.

Expression System

E. coli

Purity

> 98% by SDS-PAGE and HPLC.

Endotoxin

< 1 EU/μg

Conjugation

Unconjugated

Note

For In vitro laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.
TARGET

Synonyms

C-X-C motif chemokine ligand 10 , C7 , IFI10 , INP10 , IP-10 , SCYB10 , crg-2 , gIP-10 , mob-1

Background

This antimicrobial gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. [provided by RefSeq, Sep 2014]

Database

Package List Price ($)
$ 299