GeneTex
  • Country / Location Selection

United States (US)

Human HMGB1 protein, His tag

Cat No. GTX17621-pro

Application

Functional Assay

Species

Human
Package
50 μg ($299)
PRODUCT

Summary

HMG1 Human Recombinant fused with 6X His tag produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 223 amino acids and having a molecular mass of 26 kDa.

PROPERTIES

Form

Lyophilized powder

Buffer

Reconstitute with ddH₂O not less than 100μg/ml. Lyophilized from 1x PBS (pH7.4).

Preservative

No preservative

Storage

Store at -20ºC or below. After reconstitution, keep as concentrated solution. For short-term storage (1-2 weeks), store at 4ºC. For long-term storage, we recommend adding a carrier protein (0.1% HSA or BSA), then aliquot and store at -20ºC or below. Avoid freeze-thaw cycles.

Region/Sequence

C-terminal His-Tag; MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKA RYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDK QPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDELEHHHHHH

Expression System

E. coli

Purity

≥ 95% by SDS-PAGE and HPLC.

Conjugation

Unconjugated

Note

For In vitro laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

high mobility group box 1 , HMG-1 , HMG1 , HMG3 , SBP-1

Database

Research Area

REFERENCE

There are currently no references for Human HMGB1 protein, His tag (GTX17621-pro). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for Human HMGB1 protein, His tag (GTX17621-pro). Be the first to share your experience with this product.
SDS
PBS.pdf
Package List Price ($)
$ 299