GeneTex
  • Country / Location Selection

United States (US)

Human IGFBP1 protein (active)

Cat No. GTX48433-pro

Application

Functional Assay

Species

Human
Package
25 μg ($369)
PRODUCT

Summary

Recombinant human IGF-BP1 is a 25.4 kDa protein consisting of 235 amino acid residues (Isoform A).

APPLICATION

Application Note

The ED₅₀ was determined by its ability to inhibit IGF-I induced proliferation of MCF-7 is < 0.5 μg/ml in the presence of 6 ng/ml of human IGF-I.

PROPERTIES

Form

Lyophilized powder

Buffer

Batch dependent (please contact us for details)

Storage

Store at -20ºC or below. After reconstitution, keep as concentrated solution. Avoid freeze-thaw cycles.

Region/Sequence

MAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN

Expression System

E. Coli

Purity

> 98%

Endotoxin

< 1 EU/μg

Conjugation

Unconjugated

Note

For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

insulin like growth factor binding protein 1 , AFBP , IBP1 , IGF-BP25 , PP12 , hIGFBP-1

Background

This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP N-terminal domain and a thyroglobulin type-I domain. The encoded protein, mainly expressed in the liver, circulates in the plasma and binds both insulin-like growth factors (IGFs) I and II, prolonging their half-lives and altering their interaction with cell surface receptors. This protein is important in cell migration and metabolism. Low levels of this protein may be associated with impaired glucose tolerance, vascular disease and hypertension in human patients. [provided by RefSeq, Aug 2017]

Database

  • Gene ID: 3484 IGFBP1

Research Area

REFERENCE

There are currently no references for Human IGFBP1 protein (active) (GTX48433-pro). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for Human IGFBP1 protein (active) (GTX48433-pro). Be the first to share your experience with this product.
Package List Price ($)
$ 369