GeneTex
  • Country / Location Selection

United States (US)

Human IL1 Alpha protein

Cat. No. GTX29615-pro

Species

Human
Package
10 μg ($299)
PRODUCT

Summary

Interleukin-1 alpha Human Recombinant produced in E.Coli is single, a non-glycosylated, Polypeptide chain containing 159 amino acids and having a molecular mass of 18.022 kDa.

PROPERTIES

Form

Lyophilized powder

Buffer

Reconstitute with ddH₂O but not less than 100μg/ml. Lyophilized from 25mM Tris-HCl (pH8.0).

Preservative

No preservative

Storage

Store at -20ºC or below. After reconstitution, keep as concentrated solution. Aliquot and avoid freeze-thaw cycles.

Region/Sequence

SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDE AV KFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITG SETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQ ILE NQA.

Expression System

E. coli

Purity

> 98% by SDS-PAGE and HPLC.

Endotoxin

< 1 EU/μg

Conjugation

Unconjugated

Note

For In vitro laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

interleukin 1 alpha , IL-1A , IL1 , IL1-ALPHA , IL1F1

Database

  • Gene ID: 3552 IL1A

Research Area

REFERENCE

There are currently no references for Human IL1 Alpha protein (GTX29615-pro). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for Human IL1 Alpha protein (GTX29615-pro). Be the first to share your experience with this product.
Package List Price ($)
$ 299