GeneTex
  • Country / Location Selection

United States (US)

Human IL1 Receptor antagonist protein (active)

Cat No. GTX48188-pro

Application

Functional Assay

Species

Human
Package
100 μg ($369)
PRODUCT

Summary

Recombinant human IL-1Ra is a 17.2 kDa protein consisting of 153 amino acid residues.

APPLICATION

Application Note

Determined by its ability to inhibit the IL-1α stimulation of murine D10S cell. The expected ED₅₀ is 20-40 ng/ml in the presence of 50 pg/ml of IL-1α

PROPERTIES

Form

Lyophilized powder

Buffer

Batch dependent (please contact us for details)

Storage

Store at -20ºC or below. After reconstitution, keep as concentrated solution. Avoid freeze-thaw cycles.

Region/Sequence

MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE

Expression System

E. Coli

Purity

> 98%

Endotoxin

< 1 EU/μg

Conjugation

Unconjugated

Note

For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

interleukin 1 receptor antagonist , DIRA , ICIL-1RA , IL-1RN , IL-1ra , IL-1ra3 , IL1F3 , IL1RA , IRAP , MVCD4

Background

The protein encoded by this gene is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses. This gene and five other closely related cytokine genes form a gene cluster spanning approximately 400 kb on chromosome 2. A polymorphism of this gene is reported to be associated with increased risk of osteoporotic fractures and gastric cancer. Several alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jan 2016]

Database

  • Gene ID: 3557 IL1RN

Research Area

REFERENCE

There are currently no references for Human IL1 Receptor antagonist protein (active) (GTX48188-pro). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for Human IL1 Receptor antagonist protein (active) (GTX48188-pro). Be the first to share your experience with this product.
Package List Price ($)
$ 369