GeneTex
  • Country / Location Selection

United States (US)

Human LIGHT protein (active)

Cat No. GTX48109-pro

Application

Functional Assay

Species

Human
Package
15 μg ($369)
PRODUCT

Summary

Recombinant human LIGHT has a calculated mass of 19.3 kDa containing 177 amino acid residues. Due to glycosylation LIGHT migrates between 20.0-22.5 kDa by SDS-PAGE under non-reducing conditions.

APPLICATION

Application Note

Determined by its cytotoxic effect on HT-29 cells (human colon adenocarcinoma cells) in the presence of human IFN-gamma.

PROPERTIES

Form

Lyophilized powder

Buffer

Batch dependent (please contact us for details)

Storage

Store at -20ºC or below. After reconstitution, keep as concentrated solution. Avoid freeze-thaw cycles.

Region/Sequence

RLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV

Expression System

Hi-5 Insect cells

Purity

> 95%

Endotoxin

< 1 EU/μg

Conjugation

Unconjugated

Note

For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

TNF superfamily member 14 , CD258 , HVEML , LIGHT , LTg

Background

The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF14, which is a member of the tumor necrosis factor receptor superfamily, and which is also known as a herpesvirus entry mediator (HVEM). This protein may function as a costimulatory factor for the activation of lymphoid cells and as a deterrent to infection by herpesvirus. This protein has been shown to stimulate the proliferation of T cells, and trigger apoptosis of various tumor cells. This protein is also reported to prevent tumor necrosis factor alpha mediated apoptosis in primary hepatocyte. Two alternatively spliced transcript variant encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Database

  • Gene ID: 8740 TNFSF14

Research Area

REFERENCE

There are currently no references for Human LIGHT protein (active) (GTX48109-pro). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for Human LIGHT protein (active) (GTX48109-pro). Be the first to share your experience with this product.
Package List Price ($)
$ 369