GeneTex
  • Country / Location Selection

United States (US)

Human MIA protein (active)

Cat No. GTX48339-pro

Application

Functional Assay

Species

Human
Package
20 μg ($369)
PRODUCT

Summary

Recombinant human MIA is a 12.2 kDa globular protein containing 108 amino acid residues including two intramolecular disulfide bonds.

APPLICATION

Application Note

The ED₅₀ was determined by the dose-dependent proliferation of the human A375 melanoma cell line. The expected ED₅₀ for this effect is 4-6 μg/ml.

PROPERTIES

Form

Lyophilized powder

Buffer

Batch dependent (please contact us for details)

Storage

Store at -20ºC or below. After reconstitution, keep as concentrated solution. Avoid freeze-thaw cycles.

Region/Sequence

MGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ

Expression System

E. Coli

Purity

> 98%

Endotoxin

< 1 EU/μg

Conjugation

Unconjugated

Note

For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

MIA SH3 domain containing , CD-RAP

Database

Research Area

REFERENCE

There are currently no references for Human MIA protein (active) (GTX48339-pro). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for Human MIA protein (active) (GTX48339-pro). Be the first to share your experience with this product.
Package List Price ($)
$ 369