GeneTex
  • Country / Location Selection

United States (US)

Human Osteopontin protein (active)

Cat No. GTX53843-pro

Application

Functional Assay

Species

Human
Package
50 μg ($199)
PRODUCT

Summary

Recombinant human Osteopontin is a 298 amino acid protein, which, due to glycosylation, migrates at an apparent molecular weight of 60.0-65.0 kDa by SDS-PAGE analysis under reducing conditions. Verified by N-terminal and Mass Spectrometry analyses (when applicable).

APPLICATION

Application Note

Determined by its ability to chemoattract human monocytes using a concentration range of 10.0-100.0 ng/ml.

PROPERTIES

Form

Lyophilized powder

Buffer

Batch dependent (please contact us for details)

Storage

Store at -20ºC or below. After reconstitution, keep as concentrated solution. Aliquot and avoid freeze-thaw cycles.

Region/Sequence

IPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEET NDFKQETLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDT DDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVV YGLRSKSKKFRRPDIQYPDATDEDITSHMESEELNGAYKAIPVAQDLNAP SDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDESNEHSDVIDS QELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN

Expression System

HEK293 cells

Purity

≥ 97% by SDS-PAGE and HPLC.

Endotoxin

< 1 EU/μg

Conjugation

Unconjugated

Note

For In vitro laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

secreted phosphoprotein 1 , BNSP , BSPI , ETA-1 , OPN

Database

Research Area

REFERENCE

There are currently no references for Human Osteopontin protein (active) (GTX53843-pro). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for Human Osteopontin protein (active) (GTX53843-pro). Be the first to share your experience with this product.