GeneTex
  • Country / Location Selection

United States (US)

Human PIGF-1 protein (active)

Cat No. GTX53849-pro

Application

Functional Assay

Species

Human
Package
25 μg ($199)
PRODUCT

Summary

Recombinant human PlGF-1 is a 29.7 kDa disulfide-linked homodimeric protein of two 132 amino acid polypeptide chains. Verified by N-terminal and Mass Spectrometry analyses (when applicable).

APPLICATION

Application Note

Determined by its ability to chemoattract human monocytes of using a concentration range of 1.0-10.0 ng/ml.

PROPERTIES

Form

Lyophilized powder

Buffer

Batch dependent (please contact us for details)

Storage

Store at -20ºC or below. After reconstitution, keep as concentrated solution. Aliquot and avoid freeze-thaw cycles.

Region/Sequence

MLPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPS EVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYV ELTFSQHVRCECRPLREKMKPERCGDAVPRR

Expression System

E. coli

Purity

≥ 95% by SDS-PAGE and HPLC.

Endotoxin

< 1 EU/μg

Conjugation

Unconjugated

Note

For In vitro laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

placental growth factor , D12S1900 , PGFL , PIGF , PLGF , PlGF-2 , SHGC-10760

Database

Research Area

REFERENCE

There are currently no references for Human PIGF-1 protein (active) (GTX53849-pro). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for Human PIGF-1 protein (active) (GTX53849-pro). Be the first to share your experience with this product.