GeneTex
  • Country / Location Selection

United States (US)

Human TIMP1 protein (active)

Cat No. GTX48124-pro

Application

Functional Assay

Species

Human
Package
10 μg ($369)
PRODUCT

Summary

Recombinant human TIMP-1 is a 20.6 kDa protein containing 184 amino acid residues.

APPLICATION

Application Note

TIMP1 activity was measured by its ability to inhibit human MMP-1 induced hydrolysis of a chromogenic peptide substrate at room temperature. Half maximal inhibition was obtained at a TIMP-1 concentration of approximately 0.5 μg/ml, when using an MMP-1 concentration of 1.6 μg/ml.

PROPERTIES

Form

Lyophilized powder

Buffer

Batch dependent (please contact us for details)

Storage

Store at -20ºC or below. After reconstitution, keep as concentrated solution. Avoid freeze-thaw cycles.

Region/Sequence

CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

Expression System

E. Coli

Purity

> 95%

Endotoxin

< 1 EU/μg

Conjugation

Unconjugated

Note

For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

TIMP metallopeptidase inhibitor 1 , CLGI , EPA , EPO , HCI , TIMP , TIMP-1

Background

This gene belongs to the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases (MMPs), a group of peptidases involved in degradation of the extracellular matrix. In addition to its inhibitory role against most of the known MMPs, the encoded protein is able to promote cell proliferation in a wide range of cell types, and may also have an anti-apoptotic function. Transcription of this gene is highly inducible in response to many cytokines and hormones. In addition, the expression from some but not all inactive X chromosomes suggests that this gene inactivation is polymorphic in human females. This gene is located within intron 6 of the synapsin I gene and is transcribed in the opposite direction. [provided by RefSeq, Jul 2008]

Database

  • Gene ID: 7076 TIMP1

Research Area

REFERENCE

There are currently no references for Human TIMP1 protein (active) (GTX48124-pro). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for Human TIMP1 protein (active) (GTX48124-pro). Be the first to share your experience with this product.