GeneTex
  • Country / Location Selection

United States (US)

Human Trefoil Factor 3 protein (active)

Cat No. GTX48132-pro

Application

Functional Assay

Species

Human
Package
20 μg ($369)
PRODUCT

Summary

Recombinant human TFF3 is a 13.2 kDa homodimeric protein consisting of two 59 amino acid chains, which includes a 40-amino acid trefoil motif containing three conserved intramolecular disulfide bonds.

APPLICATION

Application Note

Determined by its ability to chemoattract human MCF-7 cells using a concentration range of 1.0-10.0 μg/ml.

PROPERTIES

Form

Lyophilized powder

Buffer

Batch dependent (please contact us for details)

Storage

Store at -20ºC or below. After reconstitution, keep as concentrated solution. Avoid freeze-thaw cycles.

Region/Sequence

EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF

Expression System

E. Coli

Purity

> 98%

Endotoxin

< 1 EU/μg

Conjugation

Unconjugated

Note

For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

trefoil factor 3 , ITF , P1B , TFI

Background

Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. This gene is expressed in goblet cells of the intestines and colon. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21. [provided by RefSeq, Jul 2008]

Database

  • Gene ID: 7033 TFF3

Research Area

REFERENCE

There are currently no references for Human Trefoil Factor 3 protein (active) (GTX48132-pro). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for Human Trefoil Factor 3 protein (active) (GTX48132-pro). Be the first to share your experience with this product.