GeneTex
  • Country / Location Selection

United States (US)

Human VEGFD protein (active)

Cat No. GTX48447-pro

Application

Functional Assay

Species

Human
Package
10 μg ($369)
PRODUCT

Summary

Recombinant human VEGF-D is a 26.2 kDa non-disulfide linked homodimeric protein consisting of two 117 amino acid polypeptide chains. Due to glycosylation the protein migrates as a 20.0-22.0 kDa band under non-reducing condition.

APPLICATION

Application Note

Measured by its ability to bind immobilized recombinant human Neuropilin-1 in an ELISA.

Observed MW

13.1 kDa.

PROPERTIES

Form

Lyophilized powder

Buffer

Batch dependent (please contact us for details)

Storage

Store at -20ºC or below. After reconstitution, keep as concentrated solution. Avoid freeze-thaw cycles.

Region/Sequence

FAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRR

Expression System

HEK293 cells

Purity

> 95%

Endotoxin

< 1 EU/μg

Conjugation

Unconjugated

Note

For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

vascular endothelial growth factor D , FIGF , VEGF-D

Background

The protein encoded by this gene is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family and is active in angiogenesis, lymphangiogenesis, and endothelial cell growth. This secreted protein undergoes a complex proteolytic maturation, generating multiple processed forms which bind and activate VEGFR-2 and VEGFR-3 receptors. This protein is structurally and functionally similar to vascular endothelial growth factor C. Read-through transcription has been observed between this locus and the upstream PIR (GeneID 8544) locus. [provided by RefSeq, Feb 2011]

Database

  • Gene ID: 2277 VEGFD

Research Area

REFERENCE

There are currently no references for Human VEGFD protein (active) (GTX48447-pro). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for Human VEGFD protein (active) (GTX48447-pro). Be the first to share your experience with this product.