GeneTex
  • Country / Location Selection

United States (US)

IL21 Receptor antibody

Anti-IL21 Receptor antibody used in Immunohistochemistry (IHC). GTX13268

Cat No. GTX13268

Host Rabbit
Clonality Polyclonal
Isotype IgG
Application FACS, ELISA, IHC
Reactivity Mouse
Package
50 μg ($319)
APPLICATION

Application Note

For ELISA (peptide): Use at a dilution of 1:100,000. For FACS: Use at a dilution of 1:20. For IHC: Use at a dilution of 1:300. Optimal dilutions/concentrations should be determined by the researcher.

Calculated MW

58 kDa. ( Note )

Positive Control

Mouse thymus/spleen
PROPERTIES

Form

Liquid

Buffer

10 mM KHPO4, 140 mM NaCl containing 0.1 % sodium azide

Storage

Store as concentrated solution. Centrifuge briefly prior to opening vial. For short-term storage (1-2 weeks), store at 4ºC. For long-term storage, aliquot and store at -20ºC or below. Avoid multiple freeze-thaw cycles.

Concentration

1 mg/ml (Please refer to the vial label for the specific concentration.)

Antigen Species

Mouse

Immunogen

Synthetic peptide: CVLETRSPNPSILSLTWQDEYEELQDQETF, corresponding to N-term amino acids 35-65 of Mouse IL21 Receptor.

Purification

Immunogen affinity purified

Conjugation

Unconjugated

Note

For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.
TARGET

Synonyms

Interleukin 21 Receptor,Nilr,Il21R

Background

The protein encoded by this gene is a cytokine receptor for interleukin 21 (IL21). It belongs to the type I cytokine receptors, and has been shown to form a heterodimeric receptor complex with the common gamma-chain, a receptor subunit also shared by the receptors for interleukin 2 (IL2) and interleukin 5 (IL5). This receptor transduces the growth promoting signal of IL21, and is important for the proliferation and differentiation of T cells, B cells, and natural killer (NK) cells. The ligand binding of this receptor leads to the activation of multiple downstream signaling molecules, including JAK1, JAK3, STAT1, and STAT3. Knockout studies of a similar gene in mouse suggest a role for this gene in regulating immunoglobulin production. Three alternatively spliced transcript variants encoding the same protein have been described.

Database

Research Area

DATA IMAGES
Anti-IL21 Receptor antibody used in Immunohistochemistry (IHC). GTX13268

GTX13268 IHC Image

Mouse thymus IL21R N term

REFERENCE
There are currently no references for IL21 Receptor antibody (GTX13268). Be the first to share your publications with this product.
REVIEW
There are currently no reviews for IL21 Receptor antibody (GTX13268). Be the first to share your experience with this product.