Form
Liquid
Buffer
PBS pH7.4, 1% BSA, 5% Sucrose
Preservative
0.025% Sodium azide
Storage
Store as concentrated solution. Centrifuge briefly prior to opening vial. For short-term storage (1-2 weeks), store at 4ºC. For long-term storage, aliquot and store at -20ºC or below. Avoid multiple freeze-thaw cycles.
Concentration
0.6 mg/ml (Please refer to the vial label for the specific concentration.)
Antigen Species
Human
Immunogen
GST fusion protein with sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523-575 (Intracellular, C-terminus) of human KV1.3 (Accession : P22001).
Purification
Depleted of anti-GST antibodies by affinity chromatography on immobilized GST and from cross-reactive antibodies on immobilized Kv1.1-GST-fusion protein, and then the antibody was purified by antigen-affinity chromatography.
From serum
Conjugation
Unconjugated
Note
For laboratory research use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.
Purchasers shall not, and agree not to enable third parties to, analyze, copy, reverse engineer or otherwise attempt to determine the structure or sequence of the product.
Synonyms
potassium voltage-gated channel subfamily A member 3 , HGK5 , HLK3 , HPCN3 , HUKIII , KV1.3 , MK3 , PCN3
Cellular Localization
Cell membrane
Background
Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. It plays an essential role in T-cell proliferation and activation. This gene appears to be intronless and it is clustered together with KCNA2 and KCNA10 genes on chromosome 1. [provided by RefSeq, Jul 2008]
Database
Research Area