GeneTex
United States (US)

Kv1.6 antibody

GTX16638_WB_18121410_909.jpg

Cat No. GTX16638

Host Rabbit
Clonality Polyclonal
Isotype IgG
Application WB, ICC/IF, IHC
Reactivity Mouse, Rat
PROPERTIES

Form

Liquid

Buffer

Reconstituted antibody containsA?phosphate buffered saline (PBS), pH 7.4, 1% BSA, 5% sucrose, 0.025% NaN3.

Storage

Store as concentrated solution. Centrifuge briefly prior to opening vial. For short-term storage (1-2 weeks), store at 4ºC. For long-term storage, aliquot and store at -20ºC or below. Avoid multiple freeze-thaw cycles.

Antigen Species

Rat

Immunogen

GST fusion protein with a sequence NYFYHRETEQEEQGQYTHVTCGQPTPDLKATDNGLGKPDFAEAS RERRSSYLPTPHRAYAEKRMLTEV, corresponding to amino acid residues 463-530 of rat Kv1.6 (Accession P17659), (MW: 35 kDa.). Intracellular, C-terminus.

Purification

The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and from antibodies cross-reactive to other Kv1 by affinity chromatography on immobilized Kv1.1-GST and Kv1.4-GST, and then the antibody was affinity purified on i

Conjugation

Unconjugated

Note

For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.
TARGET

Synonyms

Potassium Voltage-Gated Channel Subfamily A Member 6,Kv1.6,Kcna6

Research Area

DATA IMAGES
GTX16638_WB_18121410_909.jpg

GTX16638 WB Image

Anti-KV1.6 - Western blot analysis of rat brain membranes: 1. Anti-Kv1.6 antibody, (1:200). 2. Anti-Kv1.6 antibody, preincubated with the control peptide antigen.

Package List Price ($)
$ 329