GeneTex
  • Country / Location Selection

United States (US)

Lysozyme antibody

Anti-Lysozyme antibody used in Western Blot (WB). GTX03467
Anti-Lysozyme antibody used in IHC (Paraffin sections) (IHC-P). GTX03467
Anti-Lysozyme antibody used in IHC (Paraffin sections) (IHC-P). GTX03467
Anti-Lysozyme antibody used in IHC (Paraffin sections) (IHC-P). GTX03467
Anti-Lysozyme antibody used in IHC (Paraffin sections) (IHC-P). GTX03467
Anti-Lysozyme antibody used in IHC (Paraffin sections) (IHC-P). GTX03467

Cat. No. GTX03467

Host

Rabbit

Clonality

Polyclonal

Isotype

IgG

Application

WB, ICC/IF, IHC-P

Reactivity

Human, Mouse, Rat
Package
100 μg ($399)

APPLICATION

Application Note

*Optimal dilutions/concentrations should be determined by the researcher.
Application Recommended Dilution
WB 0.1-0.5μg/ml
ICC/IF 5μg/ml
IHC-P 0.5-1μg/ml

Note :

IHC-P
Antigen retireval by heat.

Not tested in other applications.

Calculated MW

17 kDa. ( Note )

PROPERTIES

Form

Liquid

Buffer

5mg BSA, 0.9mg NaCl, 0.2mg Na₂HPO₄

Preservative

0.05mg sodium azide

Storage

Store as concentrated solution. Centrifuge briefly prior to opening vial. For short-term storage (1-2 weeks), store at 4ºC. For long-term storage, aliquot and store at -20ºC or below. Avoid multiple freeze-thaw cycles.

Concentration

0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Antigen Species

Human

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human Lysozyme (106-141aa; NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ).

Purification

Purified by antigen-affinity chromatography

Conjugation

Unconjugated

Note

For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

lysozyme , LYZF1 , LZM

Cellular Localization

Secreted

Background

This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta[1-4]glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. The protein has antibacterial activity against a number of bacterial species. Missense mutations in this gene have been identified in heritable renal amyloidosis. [provided by RefSeq, Oct 2014]

Database

Research Area

DATA IMAGES

Anti-Lysozyme antibody used in Western Blot (WB). GTX03467

GTX03467 WB Image

WB analysis of various sample lysates using GTX03467 Lysozyme antibody.
Lane 1 : Rat intestine tissue lysate at 50μg
Lane 2 : Rat kidney tissue lysate at 50μg
Lane 3 : Rat Liver tissue lysate at 50μg
Lane 4 : HeLa whole cell lysate at 40μg
Lane 5 : SW620 whole cell lysate at 40μg
Lane 6 : 293T whole cell lysate at 40μg
Lane 7 : HepG2 whole cell lysate at 40μg
Dilution : 0.5 μg/ml

Anti-Lysozyme antibody used in IHC (Paraffin sections) (IHC-P). GTX03467

GTX03467 IHC-P Image

IHC-P analysis of human intestinal cancer tissue using GTX03467 Lysozyme antibody.
Antigen retireval : Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution).
Dilution : 1 μg/ml

Anti-Lysozyme antibody used in IHC (Paraffin sections) (IHC-P). GTX03467

GTX03467 IHC-P Image

IHC-P analysis of mouse ileum tissue using GTX03467 Lysozyme antibody.
Antigen retireval : Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins.
Blue : DAPI
Dilution : 5μg/ml

Anti-Lysozyme antibody used in IHC (Paraffin sections) (IHC-P). GTX03467

GTX03467 IHC-P Image

IHC-P analysis of human ileum tissue using GTX03467 Lysozyme antibody.
Antigen retireval : Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins.
Blue : DAPI
Dilution : 5μg/ml

Anti-Lysozyme antibody used in IHC (Paraffin sections) (IHC-P). GTX03467

GTX03467 IHC-P Image

IHC-P analysis of human colon organoid tissue using GTX03467 Lysozyme antibody.
Antigen retireval : Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins.
Blue : DAPI
Dilution : 5μg/ml

Anti-Lysozyme antibody used in IHC (Paraffin sections) (IHC-P). GTX03467

GTX03467 IHC-P Image

IHC-P analysis of mouse ileum organoid tissue using GTX03467 Lysozyme antibody.
Antigen retireval : Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins
Blue : DAPI
Dilution : 5μg/ml

REFERENCE

There are currently no references for Lysozyme antibody (GTX03467). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for Lysozyme antibody (GTX03467). Be the first to share your experience with this product.
Package List Price ($)
$ 399