GeneTex
United States (US)

MAP3K1 antibody [2F6]

Anti-MAP3K1 antibody [2F6] used in IHC (Paraffin sections) (IHC-P). GTX34816
Anti-MAP3K1 antibody [2F6] used in IHC (Paraffin sections) (IHC-P). GTX34816
Anti-MAP3K1 antibody [2F6] used in IHC (Paraffin sections) (IHC-P). GTX34816

Cat No. GTX34816

Host Mouse
Clonality Monoclonal
Clone Name 2F6
Isotype IgG2a
Application WB, ICC/IF, IHC-P
Reactivity Human
APPLICATION

Application Note

*Optimal dilutions/concentrations should be determined by the researcher.
Application Dilution
WB 0.5-1ug/ml
ICC/IF 1-2ug/ml
IHC-P 0.5-1ug/ml for 30 minutes at RT

Note :

IHC-P
Boiling tissue sections in 10mM Tris with 1mM EDTA, pH 9.0, for 10-20 min followed by cooling at RT for 20 minutes

Not tested in other applications.

Calculated MW

164 kDa. ( Note )

Specificity/Sensitivity

Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NFĪŗB pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.
PROPERTIES

Form

Liquid

Buffer

Prepared in 10mM PBS with 0.05% BSA and 0.05% azide.

Storage

Store as concentrated solution. Centrifuge briefly prior to opening vial. For short-term storage (1-2 weeks), store at 4ºC. For long-term storage, aliquot and store at -20ºC or below. Avoid multiple freeze-thaw cycles.

Immunogen

Partial recombinant MAP3K1 (aa1211-1310) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)

Purification

Ab purified from Bioreactor Concentrate by Protein A/G

Conjugation

Unconjugated

Note

For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.
TARGET

Synonyms

Mitogen-Activated Protein Kinase Kinase Kinase 1,Mapkkk1,Mekk,Mekk 1,Mekk1,Srxy6,Map3K1

Background

The protein encoded by this gene is a serine/threonine kinase and is part of some signal transduction cascades, including the ERK and JNK kinase pathways as well as the NF-kappa-B pathway. The encoded protein is activated by autophosphorylation and requires magnesium as a cofactor in phosphorylating other proteins. This protein has E3 ligase activity conferred by a plant homeodomain (PHD) in its N-terminus and phospho-kinase activity conferred by a kinase domain in its C-terminus. [provided by RefSeq, Mar 2012]

Database

Research Area

DATA IMAGES
Anti-MAP3K1 antibody [2F6] used in IHC (Paraffin sections) (IHC-P). GTX34816

GTX34816 IHC-P Image

Formalin-fixed, paraffin-embedded human Cervical Carcinoma stained with MAP3K1 Monoclonal Antibody (2F6).

Anti-MAP3K1 antibody [2F6] used in IHC (Paraffin sections) (IHC-P). GTX34816

GTX34816 IHC-P Image

Formalin-fixed, paraffin-embedded human Uterine Carcinoma stained with MAP3K1 Monoclonal Antibody (2F6).

Anti-MAP3K1 antibody [2F6] used in IHC (Paraffin sections) (IHC-P). GTX34816

GTX34816 IHC-P Image

Formalin-fixed, paraffin-embedded human Thyroid Carcinoma stained with MAP3K1 Monoclonal Antibody (2F6).

Package List Price ($)
$ 329