GeneTex
  • Country / Location Selection

United States (US)

MAP3K1 antibody [2F6]

Anti-MAP3K1 antibody [2F6] used in IHC (Paraffin sections) (IHC-P). GTX34816
Anti-MAP3K1 antibody [2F6] used in IHC (Paraffin sections) (IHC-P). GTX34816
Anti-MAP3K1 antibody [2F6] used in IHC (Paraffin sections) (IHC-P). GTX34816

Cat No. GTX34816

Host

Mouse

Clonality

Monoclonal

Clone Name

2F6

Isotype

IgG2a

Application

WB, IHC-P

Reactivity

Human
Package
100 μg ($469)

APPLICATION

Application Note

*Optimal dilutions/concentrations should be determined by the researcher.
Application Dilution
WB 1-2μg/ml
IHC-P 1-2μg/ml for 30 minutes at RT

Note :

IHC-P
Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris with 1mM EDTA, pH 9.0, for 45 min at 95ºC followed by cooling at RT for 20 minutes.

Not tested in other applications.

Calculated MW

164 kDa. ( Note )

PROPERTIES

Form

Liquid

Buffer

10mM PBS, 0.05% BSA

Preservative

0.05% Sodium azide

Storage

Store as concentrated solution. Centrifuge briefly prior to opening vial. For short-term storage (1-2 weeks), store at 4ºC. For long-term storage, aliquot and store at -20ºC or below. Avoid multiple freeze-thaw cycles.

Concentration

0.2 mg/ml (Please refer to the vial label for the specific concentration.)

Immunogen

Partial recombinant MAP3K1 (aa1077-1176) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)

Purification

Protein A/G purified

Conjugation

Unconjugated

Note

For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

MAP3K1 , MAPKKK1 , MEKK , MEKK 1 , MEKK1 , SRXY6 , mitogenactivated protein kinase kinase kinase 1 , MEK kinase-1 , mitogen-activated protein kinase kinase kinase 1

Background

The protein encoded by this gene is a serine/threonine kinase and is part of some signal transduction cascades, including the ERK and JNK kinase pathways as well as the NF-kappa-B pathway. The encoded protein is activated by autophosphorylation and requires magnesium as a cofactor in phosphorylating other proteins. This protein has E3 ligase activity conferred by a plant homeodomain (PHD) in its N-terminus and phospho-kinase activity conferred by a kinase domain in its C-terminus. [provided by RefSeq, Mar 2012]

Database

Research Area

DATA IMAGES

Anti-MAP3K1 antibody [2F6] used in IHC (Paraffin sections) (IHC-P). GTX34816

GTX34816 IHC-P Image

IHC-P analysis of human cervical carcinoma tissue using GTX34816 MAP3K1 antibody [2F6].

Anti-MAP3K1 antibody [2F6] used in IHC (Paraffin sections) (IHC-P). GTX34816

GTX34816 IHC-P Image

IHC-P analysis of human thyroid carcinoma tissue using GTX34816 MAP3K1 antibody [2F6].

Anti-MAP3K1 antibody [2F6] used in IHC (Paraffin sections) (IHC-P). GTX34816

GTX34816 IHC-P Image

IHC-P analysis of human uterine carcinoma tissue using GTX34816 MAP3K1 antibody [2F6].

REFERENCE

There are currently no references for MAP3K1 antibody [2F6] (GTX34816). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for MAP3K1 antibody [2F6] (GTX34816). Be the first to share your experience with this product.
SDS
PBS.pdf
Sodium Azide.pdf
Package List Price ($)
$ 469