GeneTex
  • Country / Location Selection

United States (US)

Mineralocorticoid Receptor antibody

Anti-Mineralocorticoid Receptor antibody used in Western Blot (WB). GTX00779
Anti-Mineralocorticoid Receptor antibody used in Western Blot (WB). GTX00779

Cat No. GTX00779

Host

Rabbit

Clonality

Polyclonal

Isotype

IgG

Application

WB

Reactivity

Human, Mouse, Rat
Package
100 μg ($319)

APPLICATION

Application Note

*Optimal dilutions/concentrations should be determined by the researcher.
Application Dilution
WB 0.1-0.5μg/ml
Not tested in other applications.

Calculated MW

107 kDa. ( Note )

Specificity/Sensitivity

Superfamily members of NR3C2 are not reactive to this antibody.

Predict Reactivity

Chicken(>80% identity)

PROPERTIES

Form

Liquid

Buffer

5mg BSA, 0.9mg NaCl, 0.2mg Na₂HPO₄, 0.05mg sodium azide

Storage

Store as concentrated solution. Centrifuge briefly prior to opening vial. For short-term storage (1-2 weeks), store at 4ºC. For long-term storage, aliquot and store at -20ºC or below. Avoid multiple freeze-thaw cycles.

Concentration

0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Antigen Species

Human

Immunogen

This antibody was raised against a synthetic peptide corresponding to a sequence at the C-terminus of human NR3C2 (950-984aa HALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.

Purification

Purified by antigen-affinity chromatography

Conjugation

Unconjugated

Note

For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

nuclear receptor subfamily 3 group C member 2 , MCR , MLR , MR , NR3C2VIT

Cellular Localization

Cytoplasm,Nucleus

Background

This gene encodes the mineralocorticoid receptor, which mediates aldosterone actions on salt and water balance within restricted target cells. The protein functions as a ligand-dependent transcription factor that binds to mineralocorticoid response elements in order to transactivate target genes. Mutations in this gene cause autosomal dominant pseudohypoaldosteronism type I, a disorder characterized by urinary salt wasting. Defects in this gene are also associated with early onset hypertension with severe exacerbation in pregnancy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]

Database

Research Area

DATA IMAGES

Anti-Mineralocorticoid Receptor antibody used in Western Blot (WB). GTX00779

GTX00779 WB Image

WB analysis of various samples using GTX00779 Mineralocorticoid Receptor antibody.
Lane 1 : Mouse Brain Tissue Lysate
Lane 2 : Rat Brain Tissue Lysate
Dilution : 0.5 μg/mL
Loading : 50μg

Anti-Mineralocorticoid Receptor antibody used in Western Blot (WB). GTX00779

GTX00779 WB Image

WB analysis of various samples using GTX00779 Mineralocorticoid Receptor antibody.
Lane 1 : Rat Kidney Tissue Lysate
Lane 2 : Mouse Kidney Tissue Lysate
Lane 3 : HeLa Whole Cell Lysate
Lane 4 : A431 Whole Cell Lysate
Dilution : 0.5 μg/mL
Loading : 50μg

REFERENCE

There are currently no references for Mineralocorticoid Receptor antibody (GTX00779). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for Mineralocorticoid Receptor antibody (GTX00779). Be the first to share your experience with this product.
SDS
Sodium Azide.pdf