GeneTex
  • Country / Location Selection

United States (US)

Mouse CXCL15 protein (active)

Cat No. GTX48053-pro

Application

Functional Assay

Species

Mouse
Package
20 μg ($369)
PRODUCT

Summary

Recombinant murine Lungkine is a 16.3 kDa CXC chemokine consisting of 142 amino acid residues, including four conserved cysteine residues present in CXC chemokines.

APPLICATION

Application Note

Determined by its ability to chemoattract human neutrophils using a concentration range of 20.0-100.0 ng/ml.

PROPERTIES

Form

Lyophilized powder

Buffer

Batch dependent (please contact us for details)

Storage

Store at -20ºC or below. After reconstitution, keep as concentrated solution. Avoid freeze-thaw cycles.

Region/Sequence

QELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITNRFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLRDSSEVSLTGSDA

Expression System

E. Coli

Purity

> 98%

Endotoxin

< 1 EU/μg

Conjugation

Unconjugated

Note

For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

chemokine (C-X-C motif) ligand 15 , Il8 , Scyb15 , lungkine , weche

Database

Research Area

REFERENCE

There are currently no references for Mouse CXCL15 protein (active) (GTX48053-pro). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for Mouse CXCL15 protein (active) (GTX48053-pro). Be the first to share your experience with this product.
Package List Price ($)
$ 369