GeneTex
  • Country / Location Selection

United States (US)

Mouse GDNF protein (active)

Cat No. GTX53876-pro

Application

Functional Assay

Species

Mouse
Package
10 μg ($199)
PRODUCT

Summary

The functional murine GDNF ligand is a disulfide-linked homodimer, of two 15.1 kDa polypeptide chains called monomers. Each monomer contains seven conserved cysteine residues, one of which is used for inter-chain disulfide bridging and the others are involved in intramolecular ring formation known as the cysteine knot configuration. Verified by N-terminal and Mass Spectrometry analyses (when applicable).

APPLICATION

Application Note

The ED₅₀ was determined by the proliferation of rat C6 cells is ≤ 0.2 ng/ml, corresponding to a specific activity of ≥ 5 x 10⁶units/mg.

Specificity/Sensitivity

cross reactivity: Rat

PROPERTIES

Form

Lyophilized powder

Buffer

Batch dependent (please contact us for details)

Storage

Store at -20ºC or below. After reconstitution, keep as concentrated solution. Aliquot and avoid freeze-thaw cycles.

Region/Sequence

MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLN VTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQAC CRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Expression System

E. coli

Purity

≥ 98% by SDS-PAGE and HPLC.

Endotoxin

< 1 EU/μg

Conjugation

Unconjugated

Note

For In vitro laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

glial cell line derived neurotrophic factor , AI385739 , ATF

Database

Research Area

REFERENCE

There are currently no references for Mouse GDNF protein (active) (GTX53876-pro). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for Mouse GDNF protein (active) (GTX53876-pro). Be the first to share your experience with this product.