GeneTex
  • Country / Location Selection

United States (US)

Mouse IL33 protein (active)

Cat No. GTX47982-pro

Application

Functional Assay

Species

Mouse
Package
10 μg ($369)
PRODUCT

Summary

Recombinant murine IL-33 is a 17.5 kDa protein containing 158 amino acid residues.

APPLICATION

Application Note

The ED₅₀ was determined by the dose-dependent stimulation of the proliferation of murine D10S cells is < 0.5 ng/ml, corresponding to a specific activity of > 2 x 10⁶units/mg.

PROPERTIES

Form

Lyophilized powder

Buffer

Batch dependent (please contact us for details)

Storage

Store at -20ºC or below. After reconstitution, keep as concentrated solution. Avoid freeze-thaw cycles.

Region/Sequence

SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI

Expression System

E. Coli

Purity

> 98%

Endotoxin

< 1 EU/μg

Conjugation

Unconjugated

Note

For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

interleukin 33 , 9230117N10Rik , Il-33 , Il1f11 , NF-HEV

Database

Research Area

REFERENCE

There are currently no references for Mouse IL33 protein (active) (GTX47982-pro). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for Mouse IL33 protein (active) (GTX47982-pro). Be the first to share your experience with this product.