GeneTex
  • Country / Location Selection

United States (US)

Mouse LIGHT protein

Cat No. GTX48016-pro

Species

Mouse
Package
20 μg ($369)
PRODUCT

Summary

Recombinant murine LIGHT is a 20.1 kDa protein containing 183 amino acid residues.

PROPERTIES

Form

Lyophilized powder

Buffer

Batch dependent (please contact us for details)

Storage

Store at -20ºC or below. After reconstitution, keep as concentrated solution. Avoid freeze-thaw cycles.

Region/Sequence

MRLHQRLGDIVAHLPDGGKGSWEKLIQDQRSHQANPAAHLTGANASLIGIGGPLLWETRLGLAFLRGLTYHDGALVTMEPGYYYVYSKVQLSGVGCPQGLANGLPITHGLYKRTSRYPKELELLVSRRSPCGRANSSRVWWDSSFLGGVVHLEAGEEVVVRVPGNRLVRPRDGTRSYFGAFMV

Expression System

E. Coli

Purity

> 98%

Endotoxin

< 1 EU/μg

Conjugation

Unconjugated

Note

For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

tumor necrosis factor (ligand) superfamily, member 14 , HVEM-L , HVEML , LIGHT , LTg , Ly113 , Tnlg1d

Database

Research Area

REFERENCE

There are currently no references for Mouse LIGHT protein (GTX48016-pro). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for Mouse LIGHT protein (GTX48016-pro). Be the first to share your experience with this product.
Package List Price ($)
$ 369