GeneTex
  • Country / Location Selection

United States (US)

Mouse RELM gamma protein

Cat No. GTX53882-pro

Species

Mouse
Package
25 μg ($199)
PRODUCT

Summary

Recombinant Murine RELM gamma is a 9.2 kDa monomeric protein containing 88 amino acid residues. Verified by N-terminal and Mass Spectrometry analyses (when applicable).

PROPERTIES

Form

Lyophilized powder

Buffer

Batch dependent (please contact us for details)

Storage

Store at -20ºC or below. After reconstitution, keep as concentrated solution. Aliquot and avoid freeze-thaw cycles.

Region/Sequence

EGTLESIVEKKVKELLANRDDCPSTVTKTFSCTSITASGRLASCPSGMTV TGCACGYGCGSWDIRDGNTCHCQCSTMDWATARCCQLA

Expression System

E. coli

Purity

≥ 98% by SDS-PAGE and HPLC.

Endotoxin

< 1 EU/μg

Conjugation

Unconjugated

Note

For In vitro laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

resistin like gamma , Fizz3 , Relmg , Xcp1

Database

REFERENCE

There are currently no references for Mouse RELM gamma protein (GTX53882-pro). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for Mouse RELM gamma protein (GTX53882-pro). Be the first to share your experience with this product.
Package List Price ($)
$ 199