GeneTex
  • Country / Location Selection

United States (US)

Mouse Wnt3a protein (active)

Cat No. GTX53886-pro

Application

Functional Assay

Species

Mouse
Package
10 μg ($199)
PRODUCT

Summary

Recombinant murine Wnt-3a is a monomeric glycoprotein containing 334 amino acid residues. Due to glycosylation, the murine Wnt-3a migrates at an apparent molecular weight of approximately 38.0-41.0 kDa by SDS-PAGE analysis under non-reducing conditions. Verified by N-terminal and Mass Spectrometry analyses (when applicable).

APPLICATION

Application Note

Determined by its ability to induced alkaline phosphatase production by CCL-226 cells. The expected ED₅₀ ​for this effect is 0.4-0.6 ng/ml.

PROPERTIES

Form

Lyophilized powder

Buffer

Batch dependent (please contact us for details)

Storage

Store at -20ºC or below. After reconstitution, keep as concentrated solution. Aliquot and avoid freeze-thaw cycles.

Region/Sequence

SYPIWWSLAVGPQYSSLSTQPILCASIPGLVPKQLRFCRNYVEIMPSVAE GVKAGIQECQHQFRGRRWNCTTVSNSLAIFGPVLDKATRESAFVHAIA SAGVAFAVTRSCAEGSAAICGCSSRLQGSPGEGWKWGGCSEDIEFGGM VSREFADARENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSGS CEVKTCWWSQPDFRTIGDFLKDKYDSASEMVVEKHRESRGWVETLRPR YTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLL CCGRGHNARTERRREKCHCVFHWCCYVSCQECTRVYDVHTCK

Expression System

Cell Culture

Purity

≥ 75% by SDS-PAGE and HPLC.

Endotoxin

< 1 EU/μg

Conjugation

Unconjugated

Note

For In vitro laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

wingless-type MMTV integration site family, member 3A , Wnt-3a , vt

Database

Research Area

REFERENCE

There are currently no references for Mouse Wnt3a protein (active) (GTX53886-pro). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for Mouse Wnt3a protein (active) (GTX53886-pro). Be the first to share your experience with this product.
Package List Price ($)
$ 199
Currently in production