GeneTex
  • Country / Location Selection

United States (US)

Rat FGF2 protein (active)

Cat No. GTX48259-pro

Application

Functional Assay

Species

Rat
Package
50 μg ($369)
PRODUCT

Summary

Recombinant rat FGF-basic is a 16.3 kDa protein consisting of 145 amino acid residues.

APPLICATION

Application Note

The ED₅₀ was determined by the dose-dependent stimulation of thymidine uptake by 3T3 cells is < 0.2 ng/ml corresponding to a specific activity of > 5 x 10⁶ units/mg.

PROPERTIES

Form

Lyophilized powder

Buffer

Batch dependent (please contact us for details)

Storage

Store at -20ºC or below. After reconstitution, keep as concentrated solution. Avoid freeze-thaw cycles.

Region/Sequence

PALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Expression System

E. Coli

Purity

> 95%

Endotoxin

< 1 EU/μg

Conjugation

Unconjugated

Note

For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

fibroblast growth factor 2 , Fgf-2 , bFGF

Background

activates the MAP kinase signaling pathway; plays a role in synaptic transmission; induces cell proliferation [RGD, Feb 2006]

Database

Research Area

REFERENCE

There are currently no references for Rat FGF2 protein (active) (GTX48259-pro). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for Rat FGF2 protein (active) (GTX48259-pro). Be the first to share your experience with this product.