GeneTex
  • Country / Location Selection

United States (US)

Rat GDNF protein (active)

Cat No. GTX48441-pro

Application

Functional Assay

Species

Rat
Package
10 μg ($369)
PRODUCT

Summary

The functional rat GDNF ligand is a disulfide-linked homodimer, of two 15 kDa polypeptide chains called monomers. Each monomer contains seven conserved cysteine residues, one of which (Cys 101) is used for inter-chain disulfide bridging and the others are involved in intramolecular ring formation known as the cysteine knot configuration.

APPLICATION

Application Note

Determined by its ability to stimulate the proliferation of rat C6 cells.

PROPERTIES

Form

Lyophilized powder

Buffer

Batch dependent (please contact us for details)

Storage

Store at -20ºC or below. After reconstitution, keep as concentrated solution. Avoid freeze-thaw cycles.

Region/Sequence

MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCEAAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDSLVYHILRKHSAKRCGCI

Expression System

E. Coli

Purity

> 98%

Endotoxin

< 1 EU/μg

Conjugation

Unconjugated

Note

For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

glial cell derived neurotrophic factor , gndf

Background

neurotrophic factor specific for midbrain dopamine neurons; binds to GDNFR-alpha and mediates activation of the Ret protein tyrosine kinase receptor [RGD, Feb 2006]

Database

Research Area

REFERENCE

There are currently no references for Rat GDNF protein (active) (GTX48441-pro). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for Rat GDNF protein (active) (GTX48441-pro). Be the first to share your experience with this product.