GeneTex
  • Country / Location Selection

United States (US)

Rat IL1 Beta protein

Cat No. GTX00410-pro

Species Rat
Package
10 μg ($299)
PRODUCT

Product Description

Interleukin-1b Rat Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 153 amino acids and having a molecular mass of 17.3 kDa.
PROPERTIES

Form

Lyophilized powder

Buffer

Reconstitute with ddH₂O but not less than 100 μg/ml.

Storage

Store at -20ºC or below. After reconstitution, keep as concentrated solution. Aliquot and avoid freeze-thaw cycles.

Region/Sequence

MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS.

Expression System

E. coli

Purity

> 95% by SDS-PAGE and HPLC.

Endotoxin

< 1 EU/μg

Conjugation

Unconjugated

Note

For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.
TARGET

Synonyms

interleukin 1 beta,IL-1F2

Background

an inflammatory cytokine [RGD, Feb 2006]

Database

REFERENCE
There are currently no references for Rat IL1 Beta protein (GTX00410-pro). Be the first to share your publications with this product.
REVIEW
There are currently no reviews for Rat IL1 Beta protein (GTX00410-pro). Be the first to share your experience with this product.
Package List Price ($)
$ 299