GeneTex
  • Country / Location Selection

United States (US)

SDF1 alpha antibody

Anti-SDF1 alpha antibody used in Western Blot (WB). GTX45117

Cat No. GTX45117

Host

Rabbit

Clonality

Polyclonal

Isotype

IgG

Application

WB, IHC-P, IP, IHC

Reactivity

Mouse, Rat
Package
100 μg ($339)

APPLICATION

Application Note

Recommended Starting Dilutions:
For WB: Use at a dilution of 1:1,000.
For IP: Use at a dilution of 1:300 - 1:500.
For IHC: Use at a dilution of 1:100 - 1:500.
Optimal dilutions/concentrations should be determined by the end user.

Calculated MW

11 kDa. ( Note )

Product Note

It recognizes both SDF-1 alpha and beta form of mouse and rat based on sequence homology

PROPERTIES

Form

Liquid

Buffer

Phosphate buffered saline, pH 7.2, containing 0.1% sodium azide

Storage

Store as concentrated solution. Centrifuge briefly prior to opening vial. For short-term storage (1-2 weeks), store at 4ºC. For long-term storage, aliquot and store at -20ºC or below. Avoid multiple freeze-thaw cycles.

Concentration

1 mg/ml (Please refer to the vial label for the specific concentration.)

Antigen Species

Mouse

Immunogen

Recombinant protein was generated using E. coli-expressed mouse SDF-1α as an immunogen.The sequence of mouse SDF-1 alpha antigen is DGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Purification

Protein A affinity purified
From polyclonal serum

Conjugation

Unconjugated

RRID

AB_1080954

Note

For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

chemokine (C-X-C motif) ligand 12 , Pbsf , Scyb12 , Sdf1 , Tlsf , Tpar1

Cellular Localization

Secreted

Background

This gene encodes a member of the alpha chemokine protein family. The encoded protein is secreted and functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4. The encoded protein plays a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013]

Database

Research Area

DATA IMAGES

Anti-SDF1 alpha antibody used in Western Blot (WB). GTX45117

GTX45117 WB Image

Detection of mouse recombinant SDF-1 alpha by Western blot

REFERENCE

REVIEW

There are currently no reviews for SDF1 alpha antibody (GTX45117). Be the first to share your experience with this product.
SDS
Sodium Azide.pdf
Package List Price ($)
$ 339