GeneTex
  • Country / Location Selection

United States (US)

TLR4 antibody

Anti-TLR4 antibody used in IHC (Paraffin sections) (IHC-P). GTX31243
Anti-TLR4 antibody used in IHC (Paraffin sections) (IHC-P). GTX31243

Cat No. GTX31243

Host

Goat

Clonality

Polyclonal

Isotype

IgG

Application

WB, IHC-P

Reactivity

Human, Mouse, Rat
Package
50 μg ($319)

APPLICATION

Application Note

*Optimal dilutions/concentrations should be determined by the researcher.
Application Dilution
WB 1/1,000
IHC-P 1/100-1/300

Note :

IHC-P
This product requires antigen retrieval using heat treatment prior to staining of paraffin sections. Sodium citrate buffer pH 6.0 is recommended for this purpose.

Not tested in other applications.

Calculated MW

96 kDa. ( Note )

PROPERTIES

Form

Liquid

Buffer

PBS, 0.1% Sodium Azide, 0.1% BSA

Storage

Store as concentrated solution. Centrifuge briefly prior to opening vial. For short-term storage (1-2 weeks), store at 4ºC. For long-term storage, aliquot and store at -20ºC or below. Avoid multiple freeze-thaw cycles.

Concentration

1.0 mg/ml (Please refer to the vial label for the specific concentration.)

Antigen Species

Human

Immunogen

Synthetic peptide LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC corresponding to amino acids 161-192 within the N-terminal region of Human TLR4.

Purification

Purified by affinity chromatography

Conjugation

Unconjugated

Note

For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

Toll Like Receptor 4 , Armd10 , Cd284 , Tlr-4 , Toll , Tlr4

Background

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This receptor has been implicated in signal transduction events induced by lipopolysaccharide (LPS) found in most gram-negative bacteria. Mutations in this gene have been associated with differences in LPS responsiveness. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]

Database

Research Area

DATA IMAGES

Anti-TLR4 antibody used in IHC (Paraffin sections) (IHC-P). GTX31243

GTX31243 IHC-P Image

IHC-P analysis of mouse spleen tissue using GTX31243 TLR4 antibody.

Anti-TLR4 antibody used in IHC (Paraffin sections) (IHC-P). GTX31243

GTX31243 IHC-P Image

IHC-P analysis of human tonsil tissue using GTX31243 TLR4 antibody.

REFERENCE

There are currently no references for TLR4 antibody (GTX31243). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for TLR4 antibody (GTX31243). Be the first to share your experience with this product.
SDS
PBS.pdf
Sodium Azide.pdf
Package List Price ($)
$ 319