  • Country / Location Selection

United States (US)

TLR5 antibody

Anti-TLR5 antibody used in IHC (Paraffin sections) (IHC-P). GTX21654

Cat No. GTX21654










100 μg ($319)


Application Note

ELISA: Use at a dilution of 1/75000. ICC: Use at a dilution of 1/500. IHC-P: Use at a dilution of 1/250. Optimal dilutions/concentrations should be determined by the end user.

Calculated MW

98 kDa. ( Note )

Positive Control

Human spleen sections or human peripheral blood.


Peptide sequence is < 50 % identical to other human TLR receptors in this region.





PBS, 1mg/ml BSA, 0.1% sodium azide, pH7.2


Store as concentrated solution. Centrifuge briefly prior to opening vial. For short-term storage (1-2 weeks), store at 4ºC. For long-term storage, aliquot and store at -20ºC or below. Avoid multiple freeze-thaw cycles.


2 mg/ml (Please refer to the vial label for the specific concentration.)

Antigen Species



Synthetic peptide: DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ, corresponding to amino acids 151-181 of Human TLR5.


Immunogen affinity purified




For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.



Toll Like Receptor 5 , Melios , Sle1 , Sleb1 , Til3 , Tlr5

Cellular Localization

Type I membrane protein


Receptors for the C - C chemokine family include CCR 1, CCR 2A, CCR 3, CCR 4, CCR 5 and the Duffy blood group antigen. The C C receptors are important in the function of T cell chemotaxis and migration of phagocytic cells to sites of inflammation.


Research Area


Anti-TLR5 antibody used in IHC (Paraffin sections) (IHC-P). GTX21654

GTX21654 IHC-P Image

IH of TLR5 on human spleen paraffin


There are currently no references for TLR5 antibody (GTX21654). Be the first to share your publications with this product.


There are currently no reviews for TLR5 antibody (GTX21654). Be the first to share your experience with this product.
Sodium Azide.pdf
Package List Price ($)
$ 319