GeneTex
  • Country / Location Selection

United States (US)

mAChR M1 antibody

Anti-mAChR M1 antibody used in IHC (Frozen sections) (IHC-Fr). GTX17525
Anti-mAChR M1 antibody used in Western Blot (WB). GTX17525
Anti-mAChR M1 antibody used in IHC (Frozen sections) (IHC-Fr). GTX17525

Cat No. GTX17525

Host

Rabbit

Clonality

Polyclonal

Isotype

IgG

Application

WB, ICC/IF, IHC-Fr

Reactivity

Human, Mouse, Rat
Package
50 μl ($569)

APPLICATION

Application Note

*Optimal dilutions/concentrations should be determined by the researcher.
Application Dilution
WB Assay dependent
ICC/IF Assay dependent
IHC-Fr Assay dependent
Not tested in other applications.

Calculated MW

51 kDa. ( Note )

Predict Reactivity

Pig, Gerbil, Rhesus Monkey(>80% identity)

PROPERTIES

Form

Liquid

Buffer

PBS pH7.4, 1% BSA

Preservative

0.05% Sodium azide

Storage

Store as concentrated solution. Centrifuge briefly prior to opening vial. For short-term storage (1-2 weeks), store at 4ºC. For long-term storage, aliquot and store at -20ºC or below. Avoid multiple freeze-thaw cycles.

Concentration

0.95 mg/ml (Please refer to the vial label for the specific concentration.)

Antigen Species

Human

Immunogen

GST fusion protein with a sequence GSETPGKGGGSSSSSERSQP GAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSS EGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDR AGKGQKPRGKEQLAKRK, corresponding to amino acid residues 227-353 ( 3rd  intracellular loop) of human M1 (Accession  : P11229).

Purification

Depleted of anti-GST antibodies by affinity chromatography on immobilized GST and purified by antigen-affinity chromatography.
From serum

Conjugation

Unconjugated

Note

For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

TARGET

Synonyms

cholinergic receptor muscarinic 1 , HM1 , M1 , M1R

Cellular Localization

Cell membrane; Multi-pass membrane protein

Background

The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 1 is involved in mediation of vagally-induced bronchoconstriction and in the acid secretion of the gastrointestinal tract. The gene encoding this receptor is localized to 11q13. [provided by RefSeq, Jul 2008]

Database

Research Area

DATA IMAGES

Anti-mAChR M1 antibody used in IHC (Frozen sections) (IHC-Fr). GTX17525

GTX17525 IHC-Fr Image

IHC-Fr analysis of rat striatum tissue using GTX17525 mAChR M1 antibody.
Panel A : Muscarinic acetylcholine receptor M1 appears in the striatum (green).
Panel B : Staining of interneurons with mouse anti-parvalbumin (PV, red).
Panel C : Merge of M1 mAChR and PV demonstrates localization of PV expressing neurons in the striatal matrix; not in striatal patches (P).

Anti-mAChR M1 antibody used in Western Blot (WB). GTX17525

GTX17525 WB Image

WB analysis of rat brain membrane lysate using GTX17525 mAChR M1 antibody preincubated with or without immunogen peptide.
Dilution : 1:200

Anti-mAChR M1 antibody used in IHC (Frozen sections) (IHC-Fr). GTX17525

GTX17525 IHC-Fr Image

IHC-Fr analysis of mouse striatum tissue using GTX17525 mAChR M1 antibody.
Panel A : Muscarinic acetylcholine receptor M1 appears in the striatum (green).
Panel B : Staining of interneurons with mouse anti-parvalbumin (PV, red).
Panel C : Merge of M1 mAChR and PV demonstrates localization of PV expressing neurons in the striatal matrix; not in striatal patches (P).

REFERENCE

There are currently no references for mAChR M1 antibody (GTX17525). Be the first to share your publications with this product.

REVIEW

There are currently no reviews for mAChR M1 antibody (GTX17525). Be the first to share your experience with this product.
SDS
PBS.pdf
Sodium Azide.pdf
Package List Price ($)
$ 569