GeneTex
United States (US)

Blue Fluorescence Protein (BFP) recombinant protein

Cat No. GTX65494

Application ELISA, Functional Assay, Apuri, Blocking
Species Rat
APPLICATION

Calculated MW

29.0 kDa. ( Note )
PROPERTIES

Form

Lyophilized powder

Buffer

Freeze Dried

Storage

Reconstitute with ddH2O. Store at -20ºC. Product is stable for at least 12 months.

Antigen Species

Rat

Expression System

E. coli

Purification


Purity was assessed by SDS-PAGE (≥97%) and by HPLC (≥97%).

Note

For laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.
TARGET

Synonyms

BFP, Blue Fluorescence Protein

Background

The recombinant Blue Fluorescent Protein (BFP) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal BFP fluorescence. The protein is a 29 kDa monomer with 259 amino acids, pI: 6.17. Ex.= 308-383 nm; Em.= 440-447 nm. The protein is engineered with 6xHis-tag on the N-terminal, which can be used for detection with anti-His-Tag antibody, or protein removal by using Ni++ beads.

BFP protein sequence:
MGSSHHHHHHSSGLVPRGSHMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATY
GKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF
FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKELLEFVTAAGITLGMDELYKDGNILGHKLEYNFNSHNVYIMADKQKN
GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSALSKDPNEKRDHMV

Research Area

Package List Price ($)
$ 339